GLP-2 (glucagon-like peptide-2): native intestinotrophic peptide research overview

Glucagon-like peptide-2 (GLP-2) is a 33-amino acid endogenous peptide hormone encoded by the proglucagon gene, co-secreted with GLP-1 from intestinal L-cells in response to nutrient ingestion. Unlike GLP-1, which acts as an incretin to stimulate insulin secretion, GLP-2 is an intestinotrophic hormone: its primary biological role is the maintenance and growth of the intestinal mucosa. GLP-2 is the parent peptide of teduglutide (Gattex/Revestive), the FDA-approved analog used in short bowel syndrome — but GLP-2 itself and teduglutide are distinct molecules with different pharmacokinetics and clinical utility. A newer next-generation analog, apraglutide, is currently in late-stage clinical development for short bowel syndrome with intestinal failure. Understanding native GLP-2 biology is foundational for interpreting the pharmacology of these analogs.

What is GLP-2?

GLP-2 is a 33-amino acid peptide encoded within the proglucagon gene (gene symbol GCG; chromosome 2p24.3 in humans), which also encodes glucagon, GLP-1, and glicentin. Tissue-specific post-translational processing of proglucagon by the prohormone convertase PC1/3 in intestinal L-cells and central nervous system neurons yields GLP-1 and GLP-2 as co-products; in alpha cells of the pancreas, the same proglucagon mRNA is processed by PC2 to yield glucagon instead. The mature human GLP-2 sequence is: HADGSFSDEMNTILDNLAARDFINWLIQTKITD (33 residues). It was first characterized and its biological activities described in a series of foundational papers by Daniel Drucker and Patricia Brubaker at the University of Toronto in the 1990s and 2000s.

The GLP-2 receptor (GLP-2R) is a class B G protein-coupled receptor expressed predominantly in the gastrointestinal tract — particularly in enteroendocrine cells, subepithelial myofibroblasts, and enteric neurons of the small intestine and colon — with more restricted expression in the central nervous system and lung compared to the ubiquitous distribution of GLP-1R. GLP-2R signaling is therefore primarily gastrointestinal in its biology, which contrasts sharply with the broader metabolic effects of GLP-1R activation. This fundamental tissue specificity explains why GLP-2 analogs are pursued for intestinal failure and short bowel syndrome rather than for diabetes or obesity.

Native GLP-2 is not approved as a pharmaceutical and is not used clinically. Its plasma half-life is extremely short — approximately 7 minutes in healthy adults — because it is rapidly cleaved at the Ala2–Glu3 position by dipeptidyl peptidase-4 (DPP-4), the same enzyme that inactivates GLP-1. This rapid inactivation precludes native GLP-2 as a therapeutic agent. Both teduglutide and apraglutide were engineered specifically to overcome this DPP-4 susceptibility.

Mechanism of action

GLP-2 acts via GLP-2R to regulate multiple aspects of intestinal mucosal biology. The primary and most clinically significant effects are: (1) stimulation of crypt cell proliferation and inhibition of villous epithelial apoptosis, increasing intestinal absorptive surface area (the intestinotrophic effect); (2) enhancement of intestinal barrier function through tight-junction stabilization; (3) reduction of intestinal permeability; (4) stimulation of hexose transport across the enterocyte brush border; (5) inhibition of gastric acid secretion and slowing of gastric emptying; and (6) increase of intestinal and mesenteric blood flow. The intestinotrophic effect is the pharmacological basis for GLP-2 analog use in short bowel syndrome: by increasing absorptive surface area and fluid/nutrient absorption efficiency, GLP-2R agonists reduce dependence on parenteral nutrition in patients with intestinal failure.

The mechanism by which GLP-2 stimulates crypt cell proliferation is indirect: GLP-2R is expressed in subepithelial myofibroblasts and enteric neurons rather than in the intestinal epithelial cells themselves, and the proliferative signal is transmitted via paracrine mediators including insulin-like growth factor-1 (IGF-1), keratinocyte growth factor (KGF/FGF7), and epidermal growth factor receptor (EGFR) ligands. This indirect mechanism has been documented in the Drucker laboratory and subsequently confirmed in multiple models. It also explains why the intestinotrophic response has a delayed onset and why chronic administration is required for maximal structural adaptation.

What the research shows

The foundational GLP-2 biology was established by Drucker et al. in a 1996 paper in Proceedings of the National Academy of Sciences documenting GLP-2's potent intestinal growth-promoting effects in rodents (PMID 8855228). Subsequent work from the Drucker and Brubaker groups characterized GLP-2 secretion in response to nutrients (particularly fat and carbohydrate), the role of luminal nutrients in L-cell GLP-2 release, and the GLP-2 receptor distribution in intestinal tissue. A key review covering GLP-2 biology and clinical development was published by Drucker et al. in Cell Metabolism in 2006 (PMID 16867499).

The clinical translation of GLP-2 biology focused on teduglutide — a GLP-2 analog with a single Gly2 substitution replacing Ala2, conferring DPP-4 resistance and extending the half-life to approximately 2 hours. Teduglutide (Gattex/Revestive) received FDA approval in December 2012 for short bowel syndrome with intestinal failure in adults, and subsequent approvals in pediatric populations. The approval was based on the STEPS trial (Jeppesen et al., Gastroenterology, 2011; PMID 21616055), which demonstrated significant reduction in weekly parenteral support volume requirements. A full overview of teduglutide is available as a separate guide on this platform.

The next-generation analog apraglutide (formerly FE 203799) was developed by VectivBio (later acquired by Ironwood Pharmaceuticals) to further improve on teduglutide's pharmacokinetic profile. Apraglutide incorporates four amino acid substitutions relative to native GLP-2 (and additional modifications relative to teduglutide), conferring full DPP-4 resistance and an elimination half-life of approximately 72 hours, enabling once-weekly subcutaneous dosing. Phase 2 data published by Eliasson et al. in Journal of Parenteral and Enteral Nutrition (2022; PMID 35150013) and metabolic balance studies (PMC 9545924) demonstrated improvements in fluid and energy absorption in short bowel syndrome patients with intestinal failure. Phase 3 trials (the STARS program) are evaluating apraglutide in SBS-IF.

Additional GLP-2 analogs under study include glepaglutide (a PEGylated GLP-2 analog developed by Zealand Pharma), which has also completed phase 3 trials in short bowel syndrome. The evolution and therapeutic potential of GLP-2 analogs has been reviewed in detail in a 2025 ScienceDirect article covering the full analog landscape (https://www.sciencedirect.com/science/article/abs/pii/S0006295225000206). Native GLP-2's role in bone metabolism has also been investigated: GLP-2 inhibits bone resorption acutely, and there is a GLP-2-bone axis regulated postprandially, documented in studies by Henriksen and colleagues. This bone biology has not yet translated to an approved clinical application.

Pharmacokinetics of native GLP-2

The plasma half-life of endogenous GLP-2 after exogenous intravenous administration in healthy human subjects is approximately 7 minutes — rapid DPP-4 cleavage at the Ala2–Glu3 bond generates the inactive metabolite GLP-2(3–33), which retains receptor affinity but has no agonist activity and may act as a partial antagonist. Following subcutaneous injection of exogenous GLP-2 in research settings, peak concentrations are achieved within 15–30 minutes; the biologically active form is quickly cleared. Endogenous postprandial GLP-2 secretion peaks approximately 1–2 hours after a meal, driven primarily by fat and carbohydrate content. Basal circulating GLP-2 levels in healthy adults are approximately 15–40 pmol/L fasting, rising to 50–150 pmol/L postprandially, as reported in studies by Brubaker et al.

The extremely short half-life of native GLP-2 — far shorter than the clinically relevant window needed for therapeutic intestinotrophic effects — is the fundamental reason why native GLP-2 itself has no clinical pharmaceutical utility despite decades of biological characterization. The therapeutic opportunity was only unlocked through development of DPP-4-resistant analogs (teduglutide, apraglutide, glepaglutide) with half-lives ranging from approximately 2 hours (teduglutide) to 72 hours (apraglutide). This PK evolution parallels the GLP-1 analog class development from exenatide (short-acting) to semaglutide (weekly).

Dose ranges from research literature

Not medical advice. These are ranges reported in research literature, not personalized recommendations. Consult your physician.

Native GLP-2 is not an approved pharmaceutical and has no approved clinical dosing regimen. In research settings, exogenous GLP-2 has been administered in human studies at doses ranging from 2.5 to 10 mcg/kg by subcutaneous or intravenous injection. These doses are research-use parameters from investigational studies; they do not constitute clinical guidance and are included here solely for completeness of the literature record. For clinical GLP-2 receptor agonist use, the relevant reference is the approved teduglutide prescribing information (Gattex, NDA 203441), which provides the FDA-approved 0.05 mg/kg once-daily subcutaneous dosing for adult short bowel syndrome.

Storage and handling

Synthetic GLP-2 for research use should be stored as lyophilized powder at −20 °C in a desiccated environment, protected from light and moisture. Upon reconstitution in sterile buffer (typically 0.1% BSA in phosphate-buffered saline at pH 7.4 for in vitro use, or physiological saline for in vivo rodent studies), solutions should be maintained at 4 °C and used within 24–48 hours to prevent degradation. Because native GLP-2 lacks the structural modifications that confer stability to teduglutide or apraglutide, research-grade GLP-2 is notably more susceptible to proteolytic degradation in biological matrices than the therapeutic analogs.

What GLP-2 is NOT

GLP-2 is not GLP-1. Despite sharing the proglucagon gene origin and initial processing steps, GLP-1 and GLP-2 act on completely different receptors (GLP-1R vs GLP-2R), in different tissues, with entirely different biological effects. GLP-1 is an incretin that drives insulin secretion and appetite suppression; GLP-2 is an intestinotrophic hormone that drives intestinal mucosal growth and function. The two peptides share no significant cross-reactivity at their cognate receptors.

GLP-2 is not teduglutide. Teduglutide is the Gly2-substituted, DPP-4-resistant analog of GLP-2 that has FDA approval for short bowel syndrome. Native GLP-2 has no such approval and no clinical use. Teduglutide's pharmacokinetic profile, clinical trial evidence, and approved indication are those of the modified analog — not of the native peptide reviewed here. A separate guide on this platform covers teduglutide specifically. GLP-2 is not apraglutide: apraglutide is a structurally more extensively modified, long-acting analog of GLP-2 with a 72-hour half-life that enables once-weekly dosing — substantially different in structure and pharmacokinetics from native GLP-2.

GLP-2 is not glucagon. Despite being encoded by the same proglucagon gene, glucagon and GLP-2 are produced by different cell types through different post-translational processing and act on different receptors (glucagon receptor vs GLP-2R) with opposite metabolic effects in many contexts. Vendors offering research peptides occasionally conflate proglucagon-derived peptides; researchers should verify the specific peptide sequence and purity for any proglucagon family member before use.

Frequently asked questions

What is the difference between GLP-2, teduglutide, and apraglutide?

GLP-2 is the native 33-amino acid hormone with a ~7-minute half-life, rapidly inactivated by DPP-4. Teduglutide is the Gly2-substituted DPP-4-resistant analog (half-life ~2 hours, FDA-approved, once-daily dosing). Apraglutide is a next-generation analog with four amino acid changes from native GLP-2, conferring full DPP-4 resistance and an ~72-hour half-life enabling once-weekly dosing. All three act on the GLP-2 receptor; the differences are entirely pharmacokinetic and structural.

Who discovered GLP-2?

GLP-2's intestinotrophic effects were first characterized by Daniel Drucker and colleagues at the University of Toronto, with the foundational publication in PNAS in 1996 (PMID 8855228). Patricia Brubaker's laboratory contributed extensively to characterizing GLP-2 secretion physiology. The history of GLP-2 discovery and teduglutide development is reviewed in Drucker et al., ACS Pharmacology & Translational Science, 2020 (PMC 7088900).

Does GLP-2 have any metabolic effects on weight or glucose?

GLP-2 has no clinically significant incretin or direct weight-loss effects via GLP-2R. Its effects are gastrointestinal, bone-related (inhibition of bone resorption), and intestinal mucosal. It does not stimulate insulin secretion or suppress appetite through the same pathways as GLP-1. Any indirect nutritional effects in short bowel syndrome patients derive from improved nutrient absorption, not from direct metabolic receptor signaling.

Is native GLP-2 available for research use?

Yes. Synthetic GLP-2 (human sequence, 33 aa) is available from specialized peptide synthesis vendors for research use. It is classified as a research peptide, not an approved pharmaceutical. Its short half-life limits utility in most in vivo models without DPP-4 inhibition or use of the GLP-2 analog tools (teduglutide, apraglutide) that are more stable.

What is apraglutide's development status as of 2026?

Apraglutide (developed by VectivBio, acquired by Ironwood Pharmaceuticals) is in phase 3 clinical development for short bowel syndrome with intestinal failure (SBS-IF). Phase 2 data showed improvements in fluid absorption and parenteral nutrition independence. The STARS phase 3 program results were anticipated in 2025–2026. Regulatory submissions have not been confirmed as approved as of May 2026.

References

1. Drucker DJ, et al. Glucagon-like peptide 2 stimulates post-natal growth of the small intestine. PNAS. 1996;93(15):7911–7916. PMID 8855228. https://pubmed.ncbi.nlm.nih.gov/8855228/

2. Drucker DJ, Yusta B. Physiology and pharmacology of the enteroendocrine hormone glucagon-like peptide-2. Cell Metabolism. 2006;3(3):153–165. PMID 16867499. https://pubmed.ncbi.nlm.nih.gov/16867499/

3. Drucker DJ. The discovery of GLP-2 and development of teduglutide for short bowel syndrome. ACS Pharmacol Transl Sci. 2020;3(3):371–378. PMC 7088900. https://pmc.ncbi.nlm.nih.gov/articles/PMC7088900/

4. Eliasson A, et al. Apraglutide, a novel GLP-2 analog, improves fluid absorption in patients with short bowel syndrome intestinal failure: phase 2 trial. JPEN. 2022. PMID 35150013. https://pubmed.ncbi.nlm.nih.gov/35150013/

5. Brubaker PL, Drucker DJ. Glucagon-like peptides regulate cell proliferation and apoptosis in the mesenchyme; implications for obesity, diabetes, and cancer. Endocrinology. 2004. PMID 11297614. https://pubmed.ncbi.nlm.nih.gov/11297614/

6. Jeppesen PB, et al. Teduglutide reduces need for parenteral support among patients with short bowel syndrome with intestinal failure. Gastroenterology. 2011. PMID 21616055. https://pubmed.ncbi.nlm.nih.gov/21616055/

7. Evolution and therapeutic potential of GLP-2 analogs. ScienceDirect 2025. https://www.sciencedirect.com/science/article/abs/pii/S0006295225000206